General Information

  • ID:  hor005619
  • Uniprot ID:  P45656
  • Protein name:  Gonadoliberin-1
  • Gene name:  gnrh1
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  GnRH family
  • Source:  Animal
  • Expression:  First expressed in late larvae (stages 62-64). Also expressed in adults. |Expressed in the forebrain from larval stages.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005183 gonadotropin hormone-releasing hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSYGLRPG
  • Length:  10(24-33)
  • Propeptide:  MKAFPTFALLFLVLLFSAHVSDAQHWSYGLRPGGKRDTESLQDMYHETPNEVALFPELERLECSVPQSRLNVLRGALMNWLEGENRKKI
  • Signal peptide:  MKAFPTFALLFLVLLFSAHVSDA
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P51922-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005619_AF2.pdbhor005619_ESM.pdb

Physical Information

Mass: 136103 Formula: C55H77N17O14
Absent amino acids: ACDEFIKMNTV Common amino acids: G
pI: 9.35 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -128 Boman Index: -1953
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 3615 Extinction Coefficient cystines: 6990
Absorbance 280nm: 776.67

Literature

  • PubMed ID:  8137750
  • Title:  The frog gonadotropin-releasing hormone-I (GnRH-I) gene has a mammalian-like expression pattern and conserved domains in GnRH-associated peptide, but brain onset is delayed until metamorphosis.